PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012573637.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB
Protein Properties Length: 476aa    MW: 52845.2 Da    PI: 4.2367
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012573637.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.7e-1757104148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT  Ed +lv++v+++G ++W+++ +++g+ R++k+c++rw ++l
   XP_012573637.1  57 KGTWTSAEDAILVEYVQKYGDRNWSAVQKKFGLARCGKSCRLRWTNHL 104
                      799******************************************996 PP

2Myb_DNA-binding42.31.7e-13110153146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE++llv+ +  l ++ W+ Ia  ++ gRt++++k++w++
   XP_012573637.1 110 KGAFTAEEEKLLVEQHYILRNK-WAQIALAFP-GRTDNEIKNYWHT 153
                      799*******************.*********.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.29952108IPR017930Myb domain
SuperFamilySSF466897.86E-2854151IPR009057Homeodomain-like
SMARTSM007172.2E-1456106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-2458111IPR009057Homeodomain-like
CDDcd001675.64E-1259104No hitNo description
PfamPF139211.3E-1560121No hitNo description
SMARTSM007179.1E-12109157IPR001005SANT/Myb domain
PROSITE profilePS5129416.995109159IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-19112157IPR009057Homeodomain-like
CDDcd001673.58E-9112153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MGSISNGADD GGSQSPVSPE EVENGGSQSS VFPEEADNED NTRGGGGGGR GDGNLKKGTW  60
TSAEDAILVE YVQKYGDRNW SAVQKKFGLA RCGKSCRLRW TNHLRPDLRK GAFTAEEEKL  120
LVEQHYILRN KWAQIALAFP GRTDNEIKNY WHTRSKRLKK AGLPIYPEEV VERAKNMNQE  180
HLNVDVGADQ GDDNNSQIEN FEIPEVVFKS FKLRPEAIVL PPYLDMQGSG SVDQSIDSIY  240
NILLGPPSKR ARLEDTTFNA LDNTTFNNNS DSYTVAIPIF DQCEKYCMLS PPSDTILCAS  300
NGYDDNLIIG SHAALNDNIS PFESDGSMMN ELNIDRHVAL NDTVYSSEPI DGCTSNELPS  360
IQYLQTQQCS LDTPVSRFPI HESVDTSIQF PPIEDPNQSV FVYPASGDLL NTRSLQDNSN  420
DTNLQEGIEK SAPKSVAYDD ICADWDESSA PLLYSDYYSI DISMFSIDEP YFKPFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30511571106B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012573637.10.0PREDICTED: transcription factor GAMYB-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.17e-55myb domain protein 81